Search store
All
Human ORF Clone
Human mirRNA Clone
Human shRNA Clone
Human & Mouse gRNA Clone
Plasmid Collection
Human ORF Adenovirus
Human mirRNA Adenovirus
Other Adenovirus
Adeno-associated Virus
Knockout Cell Line
  • Home
  • Products
    • Adeno-associated Virus
      • GRAB Sensor
      • AAV Control
      • AAV Tool
      • Viral Transduction Kit
    • Adenovirus
      • Human mirRNA Adenovirus
      • Other Adenovirus
      • Human ORF Adenovirus
    • Lentivirus
      • COVID-19 Lentivirus
      • Lentivirus Control
      • Lentivirus Tool
      • CRISPR/Cas9 Lentivirus
    • Plasmid
      • Human ORF
      • Human mirRNA
      • Human shRNA
      • Human & Mouse gRNA
    • Reagent
      • Transfection Reagent
      • Viral Transduction Enhancer
    • Knockout Cell Line
  • Virus Packaging
    • Adeno-associated Virus
    • Adenovirus
  • Cloning Services
    • Molecular Cloning
    • Site-directed Mutagenesis
    • shRNA Cloning
    • CRISPR/Cas9 Cloning
    • Plasmid Collection
      • Viral Expression Vector
      • Viral Packaging Vector
  • AAV quality services
    • Validation Services
      • Knockout Validation
      • Knockdown Validation
      • Overexpression Validation
    • AAV Serotype Screening
    • Cell Line Generation
      • Knockout Cell Line
      • Stable Cell Line
    • AAV Infection titer services
  • Resources
    • FAQs
    • Product Literature
  • About US
    • Company Overview
Logo
  • Home
  • Products
    • Adeno-associated Virus
    • Adenovirus
    • Lentivirus
    • Plasmid
    • Reagent
    • Knockout Cell Line
  • Virus Packaging
    • Adeno-associated Virus
    • Adenovirus
  • Cloning Services
    • Molecular Cloning
    • Site-directed Mutagenesis
    • shRNA Cloning
    • CRISPR/Cas9 Cloning
    • Plasmid Collection
  • AAV quality services
    • Validation Services
    • AAV Serotype Screening
    • Cell Line Generation
    • AAV Infection titer services
  • Resources
    • FAQs
    • Product Literature
  • About US
    • Company Overview

Products

  • Adeno-associated Virus
  • Adenovirus
  • Lentivirus
  • Plasmid
  • Reagent
  • Knockout Cell Line

Products

  • Adeno-associated Virus
  • Adenovirus
  • Lentivirus
  • Plasmid
  • Reagent
  • Knockout Cell Line

Virus Packaging

  • Adeno-associated Virus
  • Adenovirus

Cloning Services

  • Molecular Cloning
  • Site-directed Mutagenesis
  • shRNA Cloning
  • CRISPR/Cas9 Cloning
  • Plasmid Collection

AAV quality services

  • Validation Services
  • AAV Serotype Screening
  • Cell Line Generation
  • AAV Infection titer services

Resources

  • FAQs
  • Product Literature

About US

  • Company Overview
Current Location:Home > Products > Plasmid
ORF of PSMC3 interacting protein (PSMC3IP), transcript variant 1 in pEnter, with C terminal Flag and His tag.

ORF of PSMC3 interacting protein (PSMC3IP), transcript variant 1 in pEnter, with C terminal Flag and His tag.

Gene No.: NM_013290
Cat No.: CH800166
Gene Name: PSMC3IP; GT198; HOP2; HUMGT198A; TBPIP
Gene Length: 618 bp
Molecular Weight: 22.66 kDa
Restriction sites: SgfI_MluI
Price: $199
Turnaround Time: next day

  • Product Information
  • DNA Sequence
  • Protein Sequence
  • Note To Purchase

Product name: Human ORF cDNA Clone

Specifications: 500ul Glycerol Stock

Shipping & Storage Conditions:
Product shipped at ambient temperature. Upon receiving, please store at -80 degree for long-term storage.

Product features:
1.All Human ORF genes are fused to C-terminal Flag & His tags;
2.All the ORF clones contains puromycin gene for stable cell line construction;
3.All the ORF clones includes kanamycin gene for positive clone selection. Its recommended working concentration is 30 ug/mL.

Handling instruction:
Streak the bacteria onto an LB agar plate. Incubate at 37 °C for overnight. Inoculate a single colony into fresh LB medium and culture overnight at 37 °C in a shaking incubator. Then extract the plasmid and sequence verification.
PS: We recommend that you should sequence it(them) upon receiving your plasmid(s).

Note:If you have any questions about how to use the product, please contact our technical support. Our email address is techsupport@wzbioscience.com.

CGCCATGAGTAAAGGCCGGGCAGAAGCTGCGGCGGGAGCCGCCGGGATCCTCCTGAGGTACCTGCAGGAGCAGAACCGGCCCTACAGCTCCCAGGATGTGTTCGGGAACCTACAGCGGGAACACGGACTGGGCAAGGCGGTGGTGGTGAAGACGCTGGAGCAGCTGGCGCAACAAGGCAAGATCAAAGAGAAGATGTACGGCAAGCAGAAGATCTATTTTGCGGATCAGGACCAGTTTGGCATGGTGAGTGATGCTGACCTTCAAGTCCTAGATGGCAAAATCGTGGCCCTCACTGCTAAGGTGCAGAGCTTGCAGCAGAGCTGCCGCTACATGGAGGCCGAGATGCAGAAAGAAATCCAGGAGTTAAAGAAGGAATGCGCTGGCTACAGAGAGAGATTGAAGAACATTAAAGCAGCTACCAATCATGTGACTCCAGAAGAGAAAGAGCAGGTGTACAGAGAGAGGCAGAAGTACTGTAAGGAGTGGAGGAAGAGGAAGAGGATGGCTACAGAGCAGTCTGATGCAATACTTGAAGGATACCCCAAGAGCAAGAAGCAGTTCTTTGAGGAAGTTGGGATAGAGACGGATgaagattacaacgTCACActcccagacccca

MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFGMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATEQSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP

WZ Biosciences' full-length cDNA clones are typically derived from human cDNAs. While 70% of our clones are identical to RefSeq or GenBank sequences, some of our cDNA clones do contain authentic SNPs that may differ from the curated RefSeq sequences by one or more nucleotides. It is highly recommended that the purchaser checks the clone sequence carefully prior to purchase. Each of our clones contains a complete Open Reading Frame (ORF) based on GenBank record in 2013, but future updates of GenBank may alter the RefSeq sequences. All of our clones are fully sequenced and validated by NextGen sequencing and match with the sequence provided on our website.


WZ Biosciences' products are to be used only for research purpose only. They may not be used for any other purposes, including, but not limited to, in vitro diagnostic purposes, therapeutics, or in humans.


WZ Biosciences' products may not be transferred to any third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to other third parties without prior written approval from WZ Biosciences, Inc.
Your use of this product is also subject to compliance with the licensing requirements listed above and described on the product’s web page at http://www.wzbio.com. It is your responsibility to review, understand and adhere to any restrictions imposed by these statements.

301-284-8288

Techsupport@wzbioscience.com

  • Products
    Adeno-associated Virus
    Adenovirus
    Lentivirus
    Plasmid
    Reagent
    Knockout Cell Line
  • Virus Packaging
    Adeno-associated Virus
    Adenovirus
  • Cloning Services
    Molecular Cloning
    Site-directed Mutagenesis
    shRNA Cloning
    CRISPR/Cas9 Cloning
    Plasmid Collection
  • AAV quality services
    Validation Services
    AAV Serotype Screening
    Cell Line Generation
    AAV Infection titer services
  • Resources
    FAQs
    Product Literature
  • Tel
  • Email
    Techsupport@wzbioscience.com
    ×
0