Search store
All
Human ORF Clone
Human mirRNA Clone
Human shRNA Clone
Human & Mouse gRNA Clone
Plasmid Collection
Human ORF Adenovirus
Human mirRNA Adenovirus
Other Adenovirus
Adeno-associated Virus
Knockout Cell Line
  • Home
  • Products
    • Adeno-associated Virus
      • GRAB Sensor
      • AAV Control
      • AAV Tool
      • Viral Transduction Kit
    • Adenovirus
      • Human mirRNA Adenovirus
      • Other Adenovirus
      • Human ORF Adenovirus
    • Lentivirus
      • COVID-19 Lentivirus
      • Lentivirus Control
      • Lentivirus Tool
      • CRISPR/Cas9 Lentivirus
    • Plasmid
      • Human ORF
      • Human mirRNA
      • Human shRNA
      • Human & Mouse gRNA
    • Reagent
      • Transfection Reagent
      • Viral Transduction Enhancer
    • Knockout Cell Line
  • Virus Packaging
    • Adeno-associated Virus
    • Adenovirus
  • Cloning Services
    • Molecular Cloning
    • Site-directed Mutagenesis
    • shRNA Cloning
    • CRISPR/Cas9 Cloning
    • Plasmid Collection
      • Viral Expression Vector
      • Viral Packaging Vector
  • AAV quality services
    • Validation Services
      • Knockout Validation
      • Knockdown Validation
      • Overexpression Validation
    • AAV Serotype Screening
    • Cell Line Generation
      • Knockout Cell Line
      • Stable Cell Line
    • AAV Infection titer services
  • Resources
    • FAQs
    • Product Literature
  • About US
    • Company Overview
Logo
  • Home
  • Products
    • Adeno-associated Virus
    • Adenovirus
    • Lentivirus
    • Plasmid
    • Reagent
    • Knockout Cell Line
  • Virus Packaging
    • Adeno-associated Virus
    • Adenovirus
  • Cloning Services
    • Molecular Cloning
    • Site-directed Mutagenesis
    • shRNA Cloning
    • CRISPR/Cas9 Cloning
    • Plasmid Collection
  • AAV quality services
    • Validation Services
    • AAV Serotype Screening
    • Cell Line Generation
    • AAV Infection titer services
  • Resources
    • FAQs
    • Product Literature
  • About US
    • Company Overview

Products

  • Adeno-associated Virus
  • Adenovirus
  • Lentivirus
  • Plasmid
  • Reagent
  • Knockout Cell Line

Products

  • Adeno-associated Virus
  • Adenovirus
  • Lentivirus
  • Plasmid
  • Reagent
  • Knockout Cell Line

Virus Packaging

  • Adeno-associated Virus
  • Adenovirus

Cloning Services

  • Molecular Cloning
  • Site-directed Mutagenesis
  • shRNA Cloning
  • CRISPR/Cas9 Cloning
  • Plasmid Collection

AAV quality services

  • Validation Services
  • AAV Serotype Screening
  • Cell Line Generation
  • AAV Infection titer services

Resources

  • FAQs
  • Product Literature

About US

  • Company Overview
Current Location:Home > Products > Adenovirus
Premade Adenovirus with ORF of transmembrane protein 8B (TMEM8B), transcript variant 2 with C terminal Flag and His tag.

Premade Adenovirus with ORF of transmembrane protein 8B (TMEM8B), transcript variant 2 with C terminal Flag and His tag.

Gene No.: NM_001042589
Cat No.: VH800178
Gene Name: TMEM8B
Gene Length: 1419 bp
Price: Quote400-077-2566
Turnaround Time: Inquire
Verify: No

  • Product Information
  • DNA Sequence
  • Protein Sequence
  • Protein Validation
  • Note To Purchase

Product name: Premade Adenovirus of Human ORFs


Specifications: Titer:≥1×10E12vp/mL;Volume:500ul


Shipping & Storage Conditions:

Product(s) shipped on dry ice. Once received, please store at -80℃ for long-term storage. Please note, Aliquot to avoid repeated freezing and thawing that can decrease the viral titer. Prior to use, please melt it(or them) at 4℃ and mix gently to ensure a uniform concentration of components.

Once an aliquot is thawed, it may be stored at 4°C for several weeks without significant loss of biological activity.


Storage Buffer:PBS


Biosafety level:Biosafety level (BSL)-2


Shelf life:1 year from date of receipt under proper storage conditions


Note:If you have any questions about how to use the product, please refer to our adenovirus manual or contact our technical support. Our email address is techsupport@wzbioscience.com.

ATGAACATGCCCCAGTCCCTGGGCAACCAGCCACTGCCCCCAGAACCGCCATCCCTTGGAACCCCTGCGGAGGGGCCTGGGACCACGTCCCCACCCGAGCACTGCTGGCCAGTGCGCCCGACTCTGCGCAACGAGCTGGACACCTTCTCTGTCCACTTCTACATCTTCTTTGGCCCAAGTGTGGCCCTTCCCCCTGAGCGCCCAGCCGTGTTCGCCATGAGGCTGTTGCCAGTGCTGGACAGTGGAGGCGTCCTCAGCCTGGAGCTCCAGCTCAATGCGAGCTCCGTGCGCCAGGAAAACGTGACGGTGTTTGGATGCTTGACTCACGAGGTGCCCTTGAGCCTGGGGGATGCAGCAGTGACCTGTTCCAAAGAGTCCCTGGCCGGCTTCCTCCTCTCTGTCAGTGCCACCACCAGGGTTGCCAGGCTGCGAATCCCATTCCCGCAGACGGGGACCTGGTTCCTGGCCCTCCGCTCCCTGTGCGGGGTGGGGCCTCGGTTCGTGCGGTGCCGCAACGCGACGGCCGAGGTGCGGATGCGCACCTTCCTGTCCCCATGCGTGGACGACTGCGGGCCCTACGGCCAGTGCAAGCTGCTGCGCACACACAATTATCTGTACGCAGCCTGCGAGTGCAAGGCCGGGTGGAGAGGCTGGGGCTGCACCGACAGTGCAGATGCGCTCACCTATGGATTCCAGCTGCTGTCCACACTCCTGCTCTGCCTGAGCAACCTCATGTTTCTGCCACCTGTGGTCCTGGCCATTCGGAGTCGATATGTGCTGGAAGCTGCAGTCTACACCTTCACCATGTTCTTCTCCACGTTCTATCATGCCTGTGACCAGCCAGGCATCGTGGTTTTCTGCATCATGGACTACGATGTGCTGCAGTTCTGTGATTTCCTGGGCTCCTTAATGTCCGTGTGGGTCACTGTCATTGCCATGGCTCGTTTACAGCCCGTGGTCAAGCAGGTGCTGTATTTGCTGGGAGCTATGCTGCTGTCCATGGCTCTGCAGCTTGACCGACATGGACTCTGGAACCTGCTTGGACCCAGTCTCTTCGCCCTGGGGATCTTGGCCACAGCCTGGACAGTACGCAGCGTCCGCCGCCGGCACTGCTACCCACCCACGTGGCGCCGCTGGCTTTTCTACTTGTGCCCTGGCAGCCTTATTGCAGGCAGTGCCGTCCTGCTTTATGCTTTTGTGGAGACCCGGGACAACTACTTCTACATTCACAGCATTTGGCATATGCTCATTGCGGGCAGTGTGGGCTTCCTGCTGCCCCCTCGTGCCAAGACTGACCACGGGGTCCCATCTGGAGCCCGGGCCCGGGGCTGTGGTTACCAGCTATGCATCAACGAGCAGGAGGAGCTGGGCCTCGTGGGCCCAGGAGGGGCCACTGTCAGCAGCATCTGTGCCAGC

MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGSVGFLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS

Waiting for Upload……

WZ Biosciences' products are to be used only for research purpose only. They may not be used for any other purposes, including, but not limited to, in vitro diagnostic purposes, therapeutics, or in humans.


WZ Biosciences' products may not be transferred to any third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to other third parties without prior written approval from WZ Biosciences, Inc.

Your use of this product is also subject to compliance with the licensing requirements listed above and described on the product's web page at http://www.wzbio.com. It is your responsibility to review, understand and adhere to any restrictions imposed by these statements.


301-284-8288

Techsupport@wzbioscience.com

  • Products
    Adeno-associated Virus
    Adenovirus
    Lentivirus
    Plasmid
    Reagent
    Knockout Cell Line
  • Virus Packaging
    Adeno-associated Virus
    Adenovirus
  • Cloning Services
    Molecular Cloning
    Site-directed Mutagenesis
    shRNA Cloning
    CRISPR/Cas9 Cloning
    Plasmid Collection
  • AAV quality services
    Validation Services
    AAV Serotype Screening
    Cell Line Generation
    AAV Infection titer services
  • Resources
    FAQs
    Product Literature
  • Tel
  • Email
    Techsupport@wzbioscience.com
    ×
0